20% OFF shipping at www.solvehub.in on orders over $79 + up to 10% OFF products
www.solvehub.in
home > Recombinant Murine Interferon-γ (rMuIFN-γ) - PR2019 > Recombinant Murine Interferon-γ (rMuIFN-γ) - PR2019
download picture
Recombinant Murine Interferon-γ (rMuIFN-γ) - PR2019Recombinant Murine Interferon (rMuIFN ) Catalogue Numbers: PR2019 20, PR2019 100, PR2019 1000 Sizes: 20g, 100g, 1. 0mg (Contact us for the 1. 0mg option) Source: Escherichia coli Molecular Weight: Approximately 15. 6 kDa, a single non glycosylated polypeptide chain containing 134 amino acids. Purity: >95% by SDS PAGE and HPLC analyses Biological Activity: encephalomyocarditis (EMC) virus. The ED50 for this effect is typically 0. 2 0. 8ng mL,
Shopping security

Shopping security

Each payment you make on thelockerguy is secured with strict SSL encryption and PCI DSS data protection protocols

Recombinant Murine Interferon-γ (rMuIFN-γ)

Catalogue Numbers: PR2019-20, PR2019-100, PR2019-1000

Sizes: 20µg, 100µg, 1.0mg (Contact us for the 1.0mg option)

Source: Escherichia coli

Molecular Weight:Approximately 15.6 kDa, a single non-glycosylated polypeptide chain containing 134 amino acids.

Purity: >95% by SDS-PAGE and HPLC analyses

Biological Activity: encephalomyocarditis (EMC) virus. The ED50 for this effect is typically 0.2- 0.8ng/mL, corresponding to a Specific Activity of >1.25 x 106 IU/mg.

Physical Appearance: Sterile Filtered White lyophilized (freeze-dried) powder.

Formulation: Lyophilized from a 0.2mm filtered solution in PBS, pH 7.4, containing 5% trehalose.

AA Sequence: MHGTVIESLESLNNYFNSSGIDVEEKSLFLDIWRNWQKDGDMKILQSQIISFYLRLFEVLKDNQAISNNISVIESHLITTFFSNSKAKKDAFMSIAKFEVNNPQVQRQAFNELIRVVHQLLPESSLRKRKRSRC

Endotoxin: Less than 1EU/mg of rMuIFN-γ as determined by LAL method.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at <-20°C. Further dilutions should be made in appropriate buffered solutions.

Storage: This lyophilized preparation is stable at 2-8°C, but should be kept at -20°C for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8°C. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20°C to -70°C. Avoid repeated freeze/thaw cycles.

Usage: This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. NOT FOR HUMAN USE. Made in China

Interferon-gamma (IFN-γ, also known as Type II interferon or immune interferon) is a cytokine produced primarily by T-lymphocytes and natural killer cells. The protein shares no significant homology with IFN-β or the various IFN-α family proteins. Mature IFN-γ exists as noncovalently-linked homodimers. Human IFN-γ is highly species specific and is biologically active only in human and primate cells.IFN-γ was originally characterized based on its antiviral activities. The protein also exerts antiproliferative, immunoregulatory and proinflammatory activities and is thus important in host defense mechanisms. IFN-γ induces the production of cytokines, upregulates the expression of class I and II MHC antigens, Fc receptor and leukocyte adhesion molecules. It modulates macrophage effector functions, influences isotype switching and potentiates the secretion of immunoglobulins by B cells. IFN-γ also augments TH1 cell expansion and may be required for TH1 cell differentiation.

Recombinant Murine Interferon-γ (rMuIFN-γ) - PR2019

Item no : 6639643423
sold recently : Login >>
US$ 130.12
Pay in 4 interest-free payments of $32.53 Learn more
Min. order: 1piece

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 2 - Jul 7

Enjoy 20% off shipping

US$ 130.12

1-11

US$ 117.11

12-35

US$ 91.08

36-59

US$ 78.07

60+

US$40

Get now

Sign up to your membership to get coupons up to

15%

Get now

Opportunity to enjoy order discount up to 15% off

Please add the products
Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

recommand products

Related Searches